PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KHN23727.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family MYB
Protein Properties Length: 846aa    MW: 95255.9 Da    PI: 8.0811
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KHN23727.1genomeTCUHKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding292.6e-09312356246
                      SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      g+WT eEd+ l+  v+ +G ++W  Ia+ +g+ Rt+ qc  r+q 
       KHN23727.1 312 GAWTNEEDKSLLLIVQDMGIRNWFDIAASLGTSRTPFQCLARFQR 356
                      79***************************************9995 PP

2Myb_DNA-binding38.33.1e-12366408346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eEd +l  av+ +G ++W ++a+ +  +Rt+ qc +rw k
       KHN23727.1 366 EWTEEEDSQLCSAVACFGARDWQSVASVLE-RRTGTQCSNRWKK 408
                      7*****************************.***********87 PP

3Myb_DNA-binding40.75.3e-13415458146
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                      +g++T+eEd +l  av ++G + W+ Ia++++ gR   qc++r+++
       KHN23727.1 415 KGSFTQEEDIRLTVAVMLFGRK-WNQIANYVP-GRIQSQCRDRYLN 458
                      799*****************99.*********.***********98 PP

4Myb_DNA-binding47.25.2e-15468509346
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                       WT+eEd++l  a+ ++G   W++Ia++++  Rt+ qc+ rw  
       KHN23727.1 468 GWTEEEDLRLEAAIVKHGYC-WSKIAEEVP-PRTDSQCRKRWKV 509
                      5*****************99.*********.9**********86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS500905.645207303IPR017877Myb-like domain
SMARTSM007170.014211307IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.607.6E-11214230IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-11278317IPR009057Homeodomain-like
SuperFamilySSF466893.02E-16287355IPR009057Homeodomain-like
PROSITE profilePS500909.605306358IPR017877Myb-like domain
SMARTSM007176.9E-9310360IPR001005SANT/Myb domain
CDDcd001671.41E-6313358No hitNo description
PfamPF139214.2E-14314375No hitNo description
Gene3DG3DSA:1.10.10.603.6E-14318371IPR009057Homeodomain-like
PROSITE profilePS5129416.388359414IPR017930Myb domain
SuperFamilySSF466891.69E-21363456IPR009057Homeodomain-like
SMARTSM007177.7E-8363412IPR001005SANT/Myb domain
CDDcd001677.43E-10366408No hitNo description
Gene3DG3DSA:1.10.10.601.4E-16372421IPR009057Homeodomain-like
SMARTSM007172.7E-12414462IPR001005SANT/Myb domain
PROSITE profilePS512949.821415460IPR017930Myb domain
PfamPF002495.2E-12415458IPR001005SANT/Myb domain
CDDcd001672.29E-7417460No hitNo description
Gene3DG3DSA:1.10.10.601.8E-18422467IPR009057Homeodomain-like
SuperFamilySSF466899.66E-23440511IPR009057Homeodomain-like
PROSITE profilePS5129421.803461515IPR017930Myb domain
SMARTSM007175.1E-13465513IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.609.2E-17468510IPR009057Homeodomain-like
PfamPF002491.5E-13468509IPR001005SANT/Myb domain
CDDcd001671.29E-12469510No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 846 aa     Download sequence    Send to blast
MKRFSTYGEG SHEGGMQMLV EGDQTSSPGY EGDIANGSIH YESYAGELCP VSQDPNEAAT  60
EELIENVEMK LSDFVESSEP DAYESSKLPQ KRLSYPPVVR CFVDAINKNR DLQRFIRSKL  120
IELEAKIEEN KKIRNKIKIL KDFQASCTRR TGNALSMKKD PRVQLISSKK PFAPKNSKKH  180
KKASAMCYGP EENSHVANYR MVLERFPLSL DRKKWSSVER ESLLKGIKQQ FQEMVLQLSL  240
SVDSSEGLLG DANDMDNVIA SVKDLEITPE RIRQFLPKVN WDLIASMYVG GRNGAECESR  300
WLNCEDPLIN QGAWTNEEDK SLLLIVQDMG IRNWFDIAAS LGTSRTPFQC LARFQRSLNP  360
AMLNSEWTEE EDSQLCSAVA CFGARDWQSV ASVLERRTGT QCSNRWKKSI CPEKKGSFTQ  420
EEDIRLTVAV MLFGRKWNQI ANYVPGRIQS QCRDRYLNSL DPSLKWGGWT EEEDLRLEAA  480
IVKHGYCWSK IAEEVPPRTD SQCRKRWKVL CPECVPLLQE ARKKRRSIIG SNFVDRESER  540
PAITLNDFLP SPALAPKSDV GASNLCKKRK SSNVPKETSK KCIKRTRLRT KEVQDTEVYS  600
DDGIKTCGEV VSACRNVSKK MRSKRHTKNT QNCPKEVVDI SCSDKVKTCI ESSESQSTFI  660
ASSGNQDSDN ITIVCFLRDK SKEMLSRFTK DLCQASFSAR ITDVSRQVES QDPFDDQIIS  720
LSQSCDTVGT KNLFVQQNAA SDTLVGTPED ANTLTGNDDD MTLACFLGNK PKKGSQAANR  780
RSACSSTIII PDGSGLSRSK HVEEETVLHG GVAEPMDIVV EKKDDELLTS LQNRPTRQRK  840
RPSRFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h89_C3e-282805077155MYB PROTO-ONCOGENE PROTEIN
1h88_C3e-282805077155MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1503525RKRWKVLCPECVPLLQEARKKRR
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150441e-149AP015044.1 Vigna angularis var. angularis DNA, chromosome 11, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006587481.10.0PREDICTED: uncharacterized protein LOC778073 isoform X2
TrEMBLA0A0B2QVS80.0A0A0B2QVS8_GLYSO; Myb-like protein L
STRINGGLYMA09G30891.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF74413344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18100.21e-165myb domain protein 4r1
Publications ? help Back to Top
  1. Qi X, et al.
    Identification of a novel salt tolerance gene in wild soybean by whole-genome sequencing.
    Nat Commun, 2014. 5: p. 4340
    [PMID:25004933]